THAP4 (NM_001164356) Human Recombinant Protein
CAT#: TP328099
Recombinant protein of human THAP domain containing 4 (THAP4), transcript variant 2, 20 µg
View other "THAP4" proteins (2)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC228099 representing NM_001164356
Red=Cloning site Green=Tags(s) MEPPKMNPVVEPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSFHPDTRKPMHRE CGFIRLKPDTNKVAFVSAQNTGVVEVEEGEVNGQELCIASHSIARISFAKEPHVEQITRKFRLNSEGKLE QTVSMATTTQPMTQHLHVTYKKVTP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001157828 |
Locus ID | 51078 |
UniProt ID | Q8WY91 |
Cytogenetics | 2q37.3 |
Refseq ORF | 495 |
Synonyms | CGI-36; Nb(III); PP238 |
Summary | In vitro catalyzes the heme-based conversion of peroxynitrite into nitrate/NO3-. May be involved in the detoxification of peroxynitrite which is responsible for the nitration of L-free tyrosine (PubMed:30524950). Also selectively binds nitric oxide/NO in vitro (PubMed:30524950).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |