MTFR1 (NM_001145838) Human Recombinant Protein
CAT#: TP327926
Purified recombinant protein of Homo sapiens mitochondrial fission regulator 1 (MTFR1), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg
View other "MTFR1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227926 representing NM_001145838
Red=Cloning site Green=Tags(s) MLGWIKRLIRMVFQQVGVSMQSINSHATEWSPSHPGEDAVASFADVGWVAKEEGECSARLRTEVRSRPPL QDDLLFFEKAPSRQISLPDLSQEEPQLKTPALANEEALQKICALENELAALRAQIAKIVTQQEQQNLTAG DLDSTTFGTIPPHPPPPPPPLPPPALGLHQSTSAVDLIKERREKRANAGKTLVKNNPKKPEMPNMLEILK EMNSVKLRSVKRSEQDVKPKPVDATDPAALIAEALKKKFAYRYRSDSQDEVEKGIPKSESEATSERVLFG PHMLKPTGKMKALIENVSDS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001139310 |
Locus ID | 9650 |
UniProt ID | Q15390 |
Cytogenetics | 8q13.1 |
Refseq ORF | 900 |
Synonyms | CHPPR; FAM54A2 |
Summary | This gene encodes a mitochondrial protein that is characterized by a poly-proline rich region. A chicken homolog of this protein promotes mitochondrial fission and the mouse homolog protects cells from oxidative stress. A related pseudogene of this gene is found on chromosome X. [provided by RefSeq, Mar 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415142 | MTFR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429023 | MTFR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415142 | Transient overexpression lysate of mitochondrial fission regulator 1 (MTFR1), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
LY429023 | Transient overexpression lysate of mitochondrial fission regulator 1 (MTFR1), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
PH327926 | MTFR1 MS Standard C13 and N15-labeled recombinant protein (NP_001139310) |
CNY 14250.00 |