alpha smooth muscle Actin (ACTA2) (NM_001141945) Human Recombinant Protein
CAT#: TP327802
Recombinant protein of human actin, alpha 2, smooth muscle, aorta (ACTA2), transcript variant 1, 20 µg
View other "alpha smooth muscle Actin" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC227802 protein sequence
Red=Cloning site Green=Tags(s) MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK YPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQA VLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREI VRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETT YNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS LSTFQQMWISKQEYDEAGPSIVHRKCF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 41.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Pull-down assay (PMID: 27991922) |
| Reference Data | |
| RefSeq | NP_001135417 |
| Locus ID | 59 |
| UniProt ID | P62736 |
| Refseq Size | 1798 |
| Cytogenetics | 10q23.31 |
| Refseq ORF | 1131 |
| Synonyms | ACTSA |
| Summary | This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a smooth muscle actin that is involved in vascular contractility and blood pressure homeostasis. Mutations in this gene cause a variety of vascular diseases, such as thoracic aortic disease, coronary artery disease, stroke, and Moyamoya disease, as well as multisystemic smooth muscle dysfunction syndrome. [provided by RefSeq, Sep 2017] |
| Protein Pathways | Vascular smooth muscle contraction |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Phosphoglycerate mutase 1 promotes cancer cell migration independent of its metabolic activity
,Zhang, D;Jin, N;Sun, W;Li, X;Liu, B;Xie, Z;Qu, J;Xu, J;Yang, X;Su, Y;Tang, S;Han, H;Chen, D;Ding, J;Tan, M;Huang, M;Geng, M;,
Oncogene
,PubMed ID 27991922
[ACTA2]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400608 | ACTA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427983 | ACTA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400608 | Transient overexpression lysate of actin, alpha 2, smooth muscle, aorta (ACTA2), transcript variant 2 |
CNY 3080.00 |
|
| LY427983 | Transient overexpression lysate of actin, alpha 2, smooth muscle, aorta (ACTA2), transcript variant 1 |
CNY 3080.00 |
|
| PH327802 | ACTA2 MS Standard C13 and N15-labeled recombinant protein (NP_001135417) |
CNY 19520.00 |
其它alpha smooth muscle Actin产品


