Tropomodulin 2 (TMOD2) (NM_001142885) Human Recombinant Protein
CAT#: TP327766
Purified recombinant protein of Homo sapiens tropomodulin 2 (neuronal) (TMOD2), transcript variant 2, 20 µg
View other "Tropomodulin 2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227766 representing NM_001142885
Red=Cloning site Green=Tags(s) MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLL MYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPIETRKEEKVTLDPELEEALASASDTELYDLAAVLGV HNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPNPTNVEISLQQMKANDPSLQEVNLNNIKAF ADMLKVNKTLTSLNIESNFITGTGILALVEALKENDTLTEIKIDNQRQQLGTAVEMEIAQMLEENSRILK FGYQFTKQGPRTRVAAAITKNNDLVRKKRVEADRR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001136357 |
Locus ID | 29767 |
UniProt ID | Q9NZR1 |
Cytogenetics | 15q21.2 |
Refseq ORF | 945 |
Synonyms | N-TMOD; NTMOD |
Summary | This gene encodes a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. The encoded protein caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Dec 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415226 | TMOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428294 | TMOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415226 | Transient overexpression lysate of tropomodulin 2 (neuronal) (TMOD2), transcript variant 1 |
CNY 3080.00 |
|
LY428294 | Transient overexpression lysate of tropomodulin 2 (neuronal) (TMOD2), transcript variant 2 |
CNY 3080.00 |
|
PH309053 | TMOD2 MS Standard C13 and N15-labeled recombinant protein (NP_055363) |
CNY 19520.00 |
|
PH327766 | TMOD2 MS Standard C13 and N15-labeled recombinant protein (NP_001136357) |
CNY 14250.00 |
|
TP309053 | Recombinant protein of human tropomodulin 2 (neuronal) (TMOD2), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Tropomodulin 2产品