MEF2BNB (BORCS8) (NM_001145784) Human Recombinant Protein
CAT#: TP327754
Recombinant protein of human hypothetical protein LOC729991 (LOC729991), transcript variant 1, 20 µg
View other "MEF2BNB" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227754 representing NM_001145784
Red=Cloning site Green=Tags(s) MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYA CSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQGHSPEEPPPPSSA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001139256 |
Locus ID | 729991 |
UniProt ID | Q96FH0 |
Cytogenetics | 19p13.11 |
Refseq ORF | 357 |
Synonyms | MEF2BNB |
Summary | As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC429006 | MEF2BNB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY429006 | Transient overexpression lysate of hypothetical protein LOC729991 (LOC729991), transcript variant 1 |
CNY 3080.00 |
|
PH327754 | LOC729991 MS Standard C13 and N15-labeled recombinant protein (NP_001139256) |
CNY 19520.00 |
其它MEF2BNB产品