RASGRP3 (NM_001139488) Human Recombinant Protein
CAT#: TP327703
Recombinant protein of human RAS guanyl releasing protein 3 (calcium and DAG-regulated) (RASGRP3), transcript variant 2, 20 µg
View other "RASGRP3" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC227703 protein sequence
Red=Cloning site Green=Tags(s) MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYRNATGESCNEF RLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSK KGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLENNPTLERSIALFNGISKWVQLMVL SKPTPQQRAEVITKFINVAKKLLQLKNFNTLMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSS NGNYCNYRKAFADCDGFKIPILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHL EPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKH IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMG PGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRFARAPSLSSGHGSL PGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGS HTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 78.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001132960 |
| Locus ID | 25780 |
| UniProt ID | Q8IV61 |
| Refseq Size | 4798 |
| Cytogenetics | 2p22.3 |
| Refseq ORF | 2070 |
| Synonyms | GRP3 |
| Summary | The protein encoded by this gene is a guanine nucleotide exchange factor that activates the oncogenes HRAS and RAP1A. Defects in this gene have been associated with systemic lupus erythematosus and several cancers. [provided by RefSeq, Mar 2017] |
| Protein Pathways | B cell receptor signaling pathway, MAPK signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403524 | RASGRP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427967 | RASGRP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY403524 | Transient overexpression lysate of RAS guanyl releasing protein 3 (calcium and DAG-regulated) (RASGRP3), transcript variant 2 |
CNY 3080.00 |
|
| LY427967 | Transient overexpression lysate of RAS guanyl releasing protein 3 (calcium and DAG-regulated) (RASGRP3), transcript variant 1 |
CNY 4840.00 |
|
| PH327703 | RASGRP3 MS Standard C13 and N15-labeled recombinant protein (NP_001132960) |
CNY 19520.00 |
|
| TP761131 | Purified recombinant protein of Human RAS guanyl releasing protein 3 (calcium and DAG-regulated) (RASGRP3), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它RASGRP3产品
