PPHLN1 (NM_001143789) Human Recombinant Protein
CAT#: TP327699
Purified recombinant protein of Homo sapiens periphilin 1 (PPHLN1), transcript variant 8, 20 µg
View other "PPHLN1" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC227699 representing NM_001143789
Red=Cloning site Green=Tags(s) MWSEGRYEYERIPRERAPPRSHPSDESGYRWTRDDHSASRQPEYRDMRDGFRRKSFYSSHYARERSPYKR DNTFFRESPVGRKDSPHSRSGSSVSSRSYSPERSKSYSFHQSQHRNKERPVQSLKTSRDTSPSSGSAVSS SKVLDKPSRLTEKELAEAASKWAAEKLEKSDESNLPEISEYEAGSTAPLFTDQPEEPESNTTHGIELFED SQLTTRSKAIASKTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSIQFALRQNLHEIGERCVEELKHFIA EYDTSTQDFGEPF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 33.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001137261 |
| Locus ID | 51535 |
| UniProt ID | Q8NEY8 |
| Cytogenetics | 12q12 |
| Refseq ORF | 879 |
| Synonyms | CR; HSPC206; HSPC232 |
| Summary | The protein encoded by this gene is one of the several proteins that become sequentially incorporated into the cornified cell envelope during the terminal differentiation of keratinocyte at the outer layers of epidermis. This protein interacts with periplakin, which is known as a precursor of the cornified cell envelope. The cellular localization pattern and insolubility of this protein suggest that it may play a role in epithelial differentiation and contribute to epidermal integrity and barrier formation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404420 | PPHLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404422 | PPHLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404430 | PPHLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428347 | PPHLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428349 | PPHLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404420 | Transient overexpression lysate of periphilin 1 (PPHLN1), transcript variant 5 |
CNY 3080.00 |
|
| LY404422 | Transient overexpression lysate of periphilin 1 (PPHLN1), transcript variant 4 |
CNY 3080.00 |
|
| LY404430 | Transient overexpression lysate of periphilin 1 (PPHLN1), transcript variant 2 |
CNY 3080.00 |
|
| LY428347 | Transient overexpression lysate of periphilin 1 (PPHLN1), transcript variant 6 |
CNY 3080.00 |
|
| LY428349 | Transient overexpression lysate of periphilin 1 (PPHLN1), transcript variant 8 |
CNY 3080.00 |
|
| PH308045 | PPHLN1 MS Standard C13 and N15-labeled recombinant protein (NP_958846) |
CNY 19520.00 |
|
| PH327699 | PPHLN1 MS Standard C13 and N15-labeled recombinant protein (NP_001137261) |
CNY 14250.00 |
|
| TP308045 | Recombinant protein of human periphilin 1 (PPHLN1), transcript variant 5, 20 µg |
CNY 2900.00 |
