Epoxide hydrolase (EPHX1) (NM_001136018) Human Recombinant Protein
CAT#: TP327627
Recombinant protein of human epoxide hydrolase 1, microsomal (xenobiotic) (EPHX1), transcript variant 2, 20 µg
View other "Epoxide hydrolase" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227627 protein sequence
Red=Cloning site Green=Tags(s) MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKF RFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHT PKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYK LMLRLGFQEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNMALVLSNFSTLTLLLGQRFGRFLGLTERDVE LLYPVKEKVFYSLMRESGYMHIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFS LDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSAFPFELLHTPEKWVRFKYPKL ISYSYMVRGGHFAAFEEPELLAQDIRKFLSVLERQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001129490 |
Locus ID | 2052 |
UniProt ID | P07099 |
Refseq Size | 1699 |
Cytogenetics | 1q42.12 |
Refseq ORF | 1365 |
Synonyms | EPHX; EPOX; HYL1; MEH |
Summary | Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity. Alternatively spliced transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Dec 2008] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Metabolism of xenobiotics by cytochrome P450 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400042 | EPHX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427767 | EPHX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400042 | Transient overexpression lysate of epoxide hydrolase 1, microsomal (xenobiotic) (EPHX1), transcript variant 1 |
CNY 3080.00 |
|
LY427767 | Transient overexpression lysate of epoxide hydrolase 1, microsomal (xenobiotic) (EPHX1), transcript variant 2 |
CNY 3080.00 |
|
PH300621 | EPHX1 MS Standard C13 and N15-labeled recombinant protein (NP_000111) |
CNY 19520.00 |
|
PH327627 | EPHX1 MS Standard C13 and N15-labeled recombinant protein (NP_001129490) |
CNY 19520.00 |
|
TP300621 | Recombinant protein of human epoxide hydrolase 1, microsomal (xenobiotic) (EPHX1), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Epoxide hydrolase产品