SERPINB2 (NM_001143818) Human Recombinant Protein
CAT＃: TP327583
Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 1, 20 µg
View other "SERPINB2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC227583 protein sequence
Red=Cloning site Green=Tags(s) MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTP MTPENFTSCGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREE YIRLCQKYYSSEPQAVDFLECAEEARKKIYSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKT PFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLE LLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLF LSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 46.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001137290 |
| Locus ID | 5055 |
| UniProt ID | P05120 |
| Refseq Size | 2180 |
| Cytogenetics | 18q21.33-q22.1 |
| Refseq ORF | 1245 |
| Synonyms | HsT1201; PAI; PAI-2; PAI2; PLANH2 |
| Summary | Inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400915 | SERPINB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428363 | SERPINB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400915 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 2 |
CNY 3080.00 |
|
| LY428363 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 1 |
CNY 3080.00 |
|
| PH303139 | SERPINB2 MS Standard C13 and N15-labeled recombinant protein (NP_002566) |
CNY 19520.00 |
|
| PH327583 | SERPINB2 MS Standard C13 and N15-labeled recombinant protein (NP_001137290) |
CNY 19520.00 |
|
| TP303139 | Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 2, 20 µg |
CNY 2900.00 |
其它SERPINB2产品
