HEF1 (NEDD9) (NM_001142393) Human Recombinant Protein
CAT＃: TP327437
Recombinant protein of human neural precursor cell expressed, developmentally down-regulated 9 (NEDD9), transcript variant 3, 20 µg
View other "HEF1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC227437 representing NM_001142393
Red=Cloning site Green=Tags(s) MWTRNLMARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPMQET ASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPSVQR SIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPVFSVPVGEIKP QGVYDIPPTKGVYAIPPSACRDEAGLREKDYDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYN CDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH NPPDAKGSRDLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQAL EMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELILHNKMKRELQ RVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPDDAKQLTTTINTNAEALFRPG PGSLHLKNGPESIMNSTEYPHGGSQGQLLHPGDHKAQAHNKALPPGLSKEQAPDCSSSDGSERSWMDDYD YVHLQGKEEFERQQKELLEKENIMKQNKMQLEHHQLSQFQLLEQEITKPVENDISKWKPSQSLPTTNSGV SAQDRQLLCFYYDQCETHFISLLNAIDALFSCVSSAQPPRIFVAHSKFVILSAHKLVFIGDTLTRQVTAQ DIRNKVMNSSNQLCEQLKTIVMATKMAALHYPSTTALQEMVHQVTDLSRNAQLFKRSLLEMATF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 92.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001135865 |
| Locus ID | 4739 |
| UniProt ID | Q14511 |
| Cytogenetics | 6p24.2 |
| Refseq ORF | 2502 |
| Synonyms | CAS-L; CAS2; CASL; CASS2; HEF1 |
| Summary | The protein encoded by this gene is a member of the CRK-associated substrates family. Members of this family are adhesion docking molecules that mediate protein-protein interactions for signal transduction pathways. This protein is a focal adhesion protein that acts as a scaffold to regulate signaling complexes important in cell attachment, migration and invasion as well as apoptosis and the cell cycle. This protein has also been reported to have a role in cancer metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401924 | NEDD9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428064 | NEDD9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY401924 | Transient overexpression lysate of neural precursor cell expressed, developmentally down-regulated 9 (NEDD9), transcript variant 1 |
CNY 3080.00 |
|
| LY428064 | Transient overexpression lysate of neural precursor cell expressed, developmentally down-regulated 9 (NEDD9), transcript variant 3 |
CNY 4840.00 |
|
| PH307200 | NEDD9 MS Standard C13 and N15-labeled recombinant protein (NP_006394) |
CNY 19520.00 |
|
| PH327437 | NEDD9 MS Standard C13 and N15-labeled recombinant protein (NP_001135865) |
CNY 19520.00 |
|
| TP307200 | Recombinant protein of human neural precursor cell expressed, developmentally down-regulated 9 (NEDD9), transcript variant 1, 20 µg |
CNY 2900.00 |
