MyoGEF (PLEKHG6) (NM_001144857) Human Recombinant Protein
CAT#: TP327365
Recombinant protein of human pleckstrin homology domain containing, family G (with RhoGef domain) member 6 (PLEKHG6), transcript variant 3, 20 µg
View other "MyoGEF" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227365 representing NM_001144857
Red=Cloning site Green=Tags(s) MGCRLHAPGEKAAHDPSRRRLQQYVPFARGSGQARGLSPMRLRDPEPEKRHGGHVGAGLLHSPKLKELTK AHELEVRLHTFSMFGMPRLPPEDRRHWEIGEGGDSGLTIEKSWRELVPGHKEMSQELCHQQEALWELLTT ELIYVRKLKIMTDLLAAGLLNLQRVGLLMEVSAETLFGNVPSLIRTHRSFWDEVLGPTLEETRASGQPLD PIGLQSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQMLCDLLIKPHQR ITKYPLLLHAVLKRSPEARAQEALNAMIEAVESFLRHINGQVRQGEEQESLAAAAQRIGPYEVLEPPSDE VEKNLRPFSTLDLTSPMLGVASEHTRQLLLEGPVRVKEGREGKLDVYLFLFSDVLLVTKPQRKADKAKVI RPPLMLEKLVCQPLRDPNSFLLIHLTEFQCVSSALLVHCPSPTDRAQWLEKTQQAQAALQKLKAEEYVQQ KRELLTLYRDQDRESPSTRPSTPSLEGSQSSAEGRTPEFSTIIPHLVVTEDTDEDAPLVPDDTSDSGYGT LIPGTPTGSRSPLSRLRQRALRRDPRLTFSTLELRDIPLRPHPPDPQAPQRRSAPELPEGILKGGSLPQE DPPTWSEEEDGASERGNVVVETLHRARLRGQLPSSPTHADSAGESPWESSGEEEEEGPLFLKAGHTSLRP MRAEDMLREIREELASQRIEGAEEPRDSRPRKLTRAQLQRMRGPHIIQLDTPLSASEV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 85.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001138329 |
Locus ID | 55200 |
UniProt ID | Q3KR16 |
Cytogenetics | 12p13.31 |
Refseq ORF | 2274 |
Synonyms | MyoGEF |
Summary | Guanine nucleotide exchange factor activating the small GTPase RHOA, which, in turn, induces myosin filament formation. Also activates RHOG. Does not activate RAC1, or to a much lower extent than RHOA and RHOG. Part of a functional unit, involving PLEKHG6, MYH10 and RHOA, at the cleavage furrow to advance furrow ingression during cytokinesis. In epithelial cells, required for the formation of microvilli and membrane ruffles on the apical pole. Along with EZR, required for normal macropinocytosis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413270 | PLEKHG6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC428528 | PLEKHG6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC428529 | PLEKHG6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY413270 | Transient overexpression lysate of pleckstrin homology domain containing, family G (with RhoGef domain) member 6 (PLEKHG6), transcript variant 1 |
CNY 4840.00 |
|
LY428528 | Transient overexpression lysate of pleckstrin homology domain containing, family G (with RhoGef domain) member 6 (PLEKHG6), transcript variant 2 |
CNY 4840.00 |
|
LY428529 | Transient overexpression lysate of pleckstrin homology domain containing, family G (with RhoGef domain) member 6 (PLEKHG6), transcript variant 3 |
CNY 4840.00 |
|
PH327365 | PLEKHG6 MS Standard C13 and N15-labeled recombinant protein (NP_001138329) |
CNY 19520.00 |