C12orf73 (NM_001135570) Human Recombinant Protein
CAT#: TP327148
Recombinant protein of human chromosome 12 open reading frame 73 (C12orf73), 20 µg
View other "C12orf73" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227148 representing NM_001135570
Red=Cloning site Green=Tags(s) MPAGVPMSTYLKMFAASLLAMCAGAEVVHRYYRPDLTIPEIPPKRGELKTELLGLKERKHKPQVSQQEEL K myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 7.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001129042 |
Locus ID | 728568 |
UniProt ID | Q69YU5 |
Cytogenetics | 12q23.3 |
Refseq ORF | 213 |
Synonyms | BR; BRAWNIN |
Summary | Essential for mitochondrial respiratory chain complex III (CIII) assembly and stability.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC427620 | C12orf73 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY427620 | Transient overexpression lysate of chromosome 12 open reading frame 73 (C12orf73) |
CNY 3080.00 |
|
PH327148 | C12orf73 MS Standard C13 and N15-labeled recombinant protein (NP_001129042) |
CNY 19520.00 |
其它C12orf73产品