C17orf49 (NM_001142799) Human Recombinant Protein
CAT#: TP326977
Recombinant protein of human chromosome 17 open reading frame 49 (C17orf49), transcript variant 3, 20 µg
View other "C17orf49" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226977 representing NM_001142799
Red=Cloning site Green=Tags(s) MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAQIKATVKRKVYEDSGIPLPAESPKKGPKKV ASGVLSPPPAAPPPSSSSVPEAGGPPIKKQKADVTLSALNDSDANSDVVDIEGLGETPPAKKLNFDQA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001136271 |
Locus ID | 124944 |
UniProt ID | Q8IXM2 |
Cytogenetics | 17p13.1 |
Refseq ORF | 414 |
Synonyms | BAP18; HEPIS |
Summary | Component of chromatin complexes such as the MLL1/MLL and NURF complexes.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406297 | C17orf49 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428281 | C17orf49 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406297 | Transient overexpression lysate of chromosome 17 open reading frame 49 (C17orf49), transcript variant 2 |
CNY 3080.00 |
|
LY428281 | Transient overexpression lysate of chromosome 17 open reading frame 49 (C17orf49), transcript variant 3 |
CNY 3080.00 |
|
PH326977 | C17orf49 MS Standard C13 and N15-labeled recombinant protein (NP_001136271) |
CNY 19520.00 |
|
TP761002 | Purified recombinant protein of Human chromosome 17 open reading frame 49 (C17orf49), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug |
CNY 2040.00 |
其它C17orf49产品