DHRS9 (NM_001142270) Human Recombinant Protein
CAT#: TP326895
Purified recombinant protein of Homo sapiens dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 3, 20 µg
View other "DHRS9" proteins (15)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226895 representing NM_001142270
Red=Cloning site Green=Tags(s) MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALK AETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFG LISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFK TNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTH YAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001135742 |
| Locus ID | 10170 |
| UniProt ID | Q9BPW9 |
| Refseq Size | 1760 |
| Cytogenetics | 2q31.1 |
| Refseq ORF | 957 |
| Synonyms | 3-alpha-HSD; 3ALPHA-HSD; RDH-E2; RDH-TBE; RDH15; RDHL; RDHTBE; RETSDR8; SDR9C4 |
| Summary | This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. This protein demonstrates oxidoreductase activity toward hydroxysteroids and is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Retinol metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404693 | DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417061 | DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427994 | DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427995 | DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429267 | DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404693 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2 |
CNY 3080.00 |
|
| LY417061 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1 |
CNY 3080.00 |
|
| LY427994 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 3 |
CNY 3080.00 |
|
| LY427995 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 4 |
CNY 3080.00 |
|
| LY429267 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1 |
CNY 3080.00 |
|
| PH320853 | DHRS9 MS Standard C13 and N15-labeled recombinant protein (NP_954674) |
CNY 19520.00 |
|
| PH326895 | DHRS9 MS Standard C13 and N15-labeled recombinant protein (NP_001135742) |
CNY 14250.00 |
|
| PH326904 | DHRS9 MS Standard C13 and N15-labeled recombinant protein (NP_001135743) |
CNY 14250.00 |
|
| TP320853 | Recombinant protein of human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP326904 | Purified recombinant protein of Homo sapiens dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 4, 20 µg |
CNY 2900.00 |
