KCTD1 (NM_001136205) Human Recombinant Protein
CAT#: TP326740
Recombinant protein of human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1, 20 µg
View other "KCTD1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226740 protein sequence
Red=Cloning site Green=Tags(s) MSRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDS LKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPC ECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERL QQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001129677 |
Locus ID | 284252 |
UniProt ID | Q719H9 |
Refseq Size | 2174 |
Cytogenetics | 18q11.2 |
Refseq ORF | 771 |
Synonyms | C18orf5 |
Summary | This gene encodes a protein containing a BTB (Broad-complex, tramtrack and bric a brac), also known as a POZ (POxvirus and zinc finger) protein-protein interaction domain. The encoded protein negatively regulates the AP-2 family of transcription factors and the Wnt signaling pathway. A mechanism for the modulation of Wnt signaling has been proposed in which the encoded protein enhances ubiquitination and degradation of the beta-catenin protein. Mutations in this gene have been identified in Scalp-ear-nipple (SEN) syndrome. [provided by RefSeq, May 2017] |
Protein Families | Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404704 | KCTD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427853 | KCTD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404704 | Transient overexpression lysate of potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 2 |
CNY 3080.00 |
|
LY427853 | Transient overexpression lysate of potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1 |
CNY 3080.00 |
|
PH319713 | KCTD1 MS Standard C13 and N15-labeled recombinant protein (NP_945342) |
CNY 19520.00 |
|
PH326740 | KCTD1 MS Standard C13 and N15-labeled recombinant protein (NP_001129677) |
CNY 19520.00 |
|
TP319713 | Recombinant protein of human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 2, 20 µg |
CNY 2900.00 |