NFYC (NM_001142589) Human Recombinant Protein
CAT＃: TP326680
Purified recombinant protein of Homo sapiens nuclear transcription factor Y, gamma (NFYC), transcript variant 4, 20 µg
View other "NFYC" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226680 representing NM_001142589
Red=Cloning site Green=Tags(s) MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKRNDIAMAITKF DQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQI IIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQL QYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPAGQDLAQPMFI QSANQPSDGQAPQVTGD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 32.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001136061 |
| Locus ID | 4802 |
| UniProt ID | Q13952 |
| Cytogenetics | 1p34.2 |
| Refseq ORF | 891 |
| Synonyms | CBF-C; CBFC; H1TF2A; HAP5; HSM; NF-YC |
| Summary | This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008] |
| Protein Families | Transcription Factors |
| Protein Pathways | Antigen processing and presentation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402291 | NFYC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428190 | NFYC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428191 | NFYC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428192 | NFYC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428193 | NFYC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402291 | Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 2 |
CNY 3080.00 |
|
| LY428190 | Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 3 |
CNY 3080.00 |
|
| LY428191 | Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 1 |
CNY 3080.00 |
|
| LY428192 | Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 4 |
CNY 3080.00 |
|
| LY428193 | Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 5 |
CNY 3080.00 |
|
| PH300060 | NFYC MS Standard C13 and N15-labeled recombinant protein (NP_055038) |
CNY 19520.00 |
|
| PH326680 | NFYC MS Standard C13 and N15-labeled recombinant protein (NP_001136061) |
CNY 14250.00 |
|
| TP300060 | Recombinant protein of human nuclear transcription factor Y, gamma (NFYC), transcript variant 2, 20 µg |
CNY 2900.00 |
