TSH Receptor (TSHR) (NM_001142626) Human Recombinant Protein
CAT#: TP326653
Purified recombinant protein of Homo sapiens thyroid stimulating hormone receptor (TSHR), transcript variant 3, 20 µg
View other "TSH Receptor" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226653 representing NM_001142626
Red=Cloning site Green=Tags(s) MRPADLLQLVLLLDLPRDLGGMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSH AFSNLPNISRIYVSIDVTLQQLESHSFYNLSKVTHIEIRNTRNLTYIDPDALKELPLLKFLGIFNTGLKM FPDLTKVYSTDIFFILEITDNPYMTSIPVNAFQGLCNETLTLKLYNNGFTSVQGYAFNGTKLDAVYLNKN KYLTVIDKDAFGGVYSGPSLLVENVAVSGKGFCKSLFSWLYRLPLGRKSLSFETQKAPRSSMPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001136098 |
| Locus ID | 7253 |
| UniProt ID | P16473 |
| Cytogenetics | 14q31.1 |
| Refseq ORF | 822 |
| Synonyms | CHNG1; hTSHR-I; LGR3 |
| Summary | The protein encoded by this gene is a membrane protein and a major controller of thyroid cell metabolism. The encoded protein is a receptor for thyrothropin and thyrostimulin, and its activity is mediated by adenylate cyclase. Defects in this gene are a cause of several types of hyperthyroidism. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008] |
| Protein Families | Druggable Genome, GPCR, Transmembrane |
| Protein Pathways | Autoimmune thyroid disease, Neuroactive ligand-receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400133 | TSHR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400133 | Transient overexpression lysate of thyroid stimulating hormone receptor (TSHR), transcript variant 1 |
CNY 4840.00 |
|
| PH326653 | TSHR MS Standard C13 and N15-labeled recombinant protein (NP_001136098) |
CNY 14250.00 |
|
| TP701226 | Purified recombinant protein of Human thyroid stimulating hormone receptor (TSHR), transcript variant 1, Met22-Gly413, with C-terminal Human FC-AVI plus and His tag, expressed in CHO cells, 50ug |
CNY 7820.00 |
其它TSH Receptor产品
