TXNL4B (NM_001142318) Human Recombinant Protein
CAT#: TP326616
Recombinant protein of human thioredoxin-like 4B (TXNL4B), transcript variant 3, 20 µg
View other "TXNL4B" proteins (10)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226616 protein sequence
Red=Cloning site Green=Tags(s) MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYT QYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIP KYDLLYQDI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 16.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001135790 |
| Locus ID | 54957 |
| UniProt ID | Q9NX01 |
| Refseq Size | 2412 |
| Cytogenetics | 16q22.2 |
| Refseq ORF | 447 |
| Synonyms | Dim2; DLP |
| Summary | Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G(2) transition.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413417 | TXNL4B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428035 | TXNL4B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428036 | TXNL4B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413417 | Transient overexpression lysate of thioredoxin-like 4B (TXNL4B), transcript variant 1 |
CNY 3080.00 |
|
| LY428035 | Transient overexpression lysate of thioredoxin-like 4B (TXNL4B), transcript variant 2 |
CNY 3080.00 |
|
| LY428036 | Transient overexpression lysate of thioredoxin-like 4B (TXNL4B), transcript variant 3 |
CNY 3080.00 |
|
| PH301503 | TXNL4B MS Standard C13 and N15-labeled recombinant protein (NP_060323) |
CNY 19520.00 |
|
| PH326616 | TXNL4B MS Standard C13 and N15-labeled recombinant protein (NP_001135790) |
CNY 19520.00 |
|
| TP301503 | Recombinant protein of human thioredoxin-like 4B (TXNL4B), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP761241 | Purified recombinant protein of Human thioredoxin-like 4B (TXNL4B), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
