SYT2 (NM_001136504) Human Recombinant Protein
CAT#: TP326544
Recombinant protein of human synaptotagmin II (SYT2), transcript variant 2, 20 µg
View other "SYT2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226544 protein sequence
Red=Cloning site Green=Tags(s) MRNIFKRNQEPIVAPATTTATMPIGPVDNSTESGGAGESQEDMFAKLKEKLFNEINKIPLPPWALIAIAV VAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENL GKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTF KVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRY VPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQI QKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 46.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001129976 |
| Locus ID | 127833 |
| UniProt ID | Q8N9I0 |
| Refseq Size | 7614 |
| Cytogenetics | 1q32.1 |
| Refseq ORF | 1257 |
| Synonyms | CMS7; MYSPC; SytII |
| Summary | This gene encodes a synaptic vesicle membrane protein. The encoded protein is thought to function as a calcium sensor in vesicular trafficking and exocytosis. Mutations in this gene are associated with myasthenic syndrome, presynaptic, congenital, with or without motor neuropathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406152 | SYT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC427901 | SYT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406152 | Transient overexpression lysate of synaptotagmin II (SYT2), transcript variant 1 |
CNY 4840.00 |
|
| LY427901 | Transient overexpression lysate of synaptotagmin II (SYT2), transcript variant 2 |
CNY 3080.00 |
|
| PH326544 | SYT2 MS Standard C13 and N15-labeled recombinant protein (NP_001129976) |
CNY 19520.00 |
