USP8 (NM_001128610) Human Recombinant Protein
CAT#: TP326336
Purified recombinant protein of Homo sapiens ubiquitin specific peptidase 8 (USP8), transcript variant 2, 20 µg
View other "USP8" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226336 representing NM_001128610
Red=Cloning site Green=Tags(s) MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVY NLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQE TGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDY QDSCILHSLSVPEEAISPGVTASWIEAHLPDDSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDA LFKWESKTVLRNEPLVLEGGYENWLLCYPQYTTNAKVTPPPRRQNEEVSISLDFTYPSLEESIPSKPAAQ TPPASIEVDENIELISGQNERMGPLNISTPVEPVAASKSDVSPIIQPVPSIKNVPQIDRTKKPAVKLPEE HRIKSESTNHEQQSPQSGKVIPDRSTKPVVFSPTLMLTDEEKARIHAETALLMEKNKQEKELRERQQEEQ KEKLRKEEQEQKAKKKQEAEENEITEKQQKAKEEMEKKESEQAKKEDKETSAKRGKEITGVKRQSKSEHE TSDAKKSVEDRGKRCPTPEIQKKSTGDVPHTSVTGDSGSGKPFKIKGQPESGILRTGTFREDTDDTERNK AQREPLTRARSEEMGRIVPGLPSGWAKFLDPITGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPPTHKAKP QIPAERDREPSKLKRSYSSPDITQAIQEEEKRKPTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFG GSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTG QYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHA WQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDN NRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKK YNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLGPRVTDVAT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 127.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001122082 |
| Locus ID | 9101 |
| UniProt ID | P40818 |
| Cytogenetics | 15q21.2 |
| Refseq ORF | 3354 |
| Synonyms | HumORF8; PITA4; SPG59; UBPY |
| Summary | This gene encodes a protein that belongs to the ubiquitin-specific processing protease family of proteins. The encoded protein is thought to regulate the morphology of the endosome by ubiquitination of proteins on this organelle and is involved in cargo sorting and membrane trafficking at the early endosome stage. This protein is required for the cell to enter the S phase of the cell cycle and also functions as a positive regulator in the Hedgehog signaling pathway in development. Pseudogenes of this gene are present on chromosomes 2 and 6. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013] |
| Protein Families | Druggable Genome, Protease |
| Protein Pathways | Endocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417494 | USP8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC426972 | USP8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC426973 | USP8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY417494 | Transient overexpression lysate of ubiquitin specific peptidase 8 (USP8), transcript variant 1 |
CNY 4840.00 |
|
| LY426972 | Transient overexpression lysate of ubiquitin specific peptidase 8 (USP8), transcript variant 2 |
CNY 4840.00 |
|
| LY426973 | Transient overexpression lysate of ubiquitin specific peptidase 8 (USP8), transcript variant 3 |
CNY 4840.00 |
|
| PH316926 | USP8 MS Standard C13 and N15-labeled recombinant protein (NP_005145) |
CNY 19520.00 |
|
| PH326336 | USP8 MS Standard C13 and N15-labeled recombinant protein (NP_001122082) |
CNY 14250.00 |
|
| PH326337 | USP8 MS Standard C13 and N15-labeled recombinant protein (NP_001122083) |
CNY 19520.00 |
|
| TP316926 | Recombinant protein of human ubiquitin specific peptidase 8 (USP8), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP326337 | Recombinant protein of human ubiquitin specific peptidase 8 (USP8), transcript variant 3, 20 µg |
CNY 2900.00 |
