CD18 (ITGB2) (NM_001127491) Human Recombinant Protein
CAT#: TP326157
Purified recombinant protein of Homo sapiens integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) (ITGB2), transcript variant 2, 20 µg
View other "CD18" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
| Cited in 2 publications. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226157 representing NM_001127491
Red=Cloning site Green=Tags(s) MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLM RGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML DDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKL TNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILT PNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSS NVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC IQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSS QELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCG KCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNVCECHSGYQLPLCQECPGCPSPCGKYISCAE CLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPN IAAIVGGTVAGIVLIGILLLVIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 82.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Far-Western blot (PMID: 26600301) ELISA binding assay (PMID: 29125705) |
| Reference Data | |
| RefSeq | NP_001120963 |
| Locus ID | 3689 |
| UniProt ID | P05107 |
| Cytogenetics | 21q22.3 |
| Refseq ORF | 2307 |
| Synonyms | CD18; LAD; LCAMB; LFA-1; MAC-1; MF17; MFI7 |
| Summary | This gene encodes an integrin beta chain, which combines with multiple different alpha chains to form different integrin heterodimers. Integrins are integral cell-surface proteins that participate in cell adhesion as well as cell-surface mediated signalling. The encoded protein plays an important role in immune response and defects in this gene cause leukocyte adhesion deficiency. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Natural killer cell mediated cytotoxicity, Regulation of actin cytoskeleton, Viral myocarditis |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Mycobacterium tuberculosis Mce3C promotes mycobacteria entry into macrophages through activation of β2 integrin-mediated signalling pathway
,Zhang, Y;Li, J;Li, B;Wang, J;Liu, CH;,
Cell. Microbiol.2017
,PubMed ID 29125705
[ITGB2]
|
|
Mutually Exclusive Roles of SHARPIN in Integrin Inactivation and NF-?B Signaling
,De Franceschi, N;Peuhu, E;Parsons, M;Rissanen, S;Vattulainen, I;Salmi, M;Ivaska, J;Pouwels, J;,
PLoS ONE
,PubMed ID 26600301
[ITGB2]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400076 | ITGB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426800 | ITGB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400076 | Transient overexpression lysate of integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) (ITGB2), transcript variant 1 |
CNY 3080.00 |
|
| LY426800 | Transient overexpression lysate of integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) (ITGB2), transcript variant 2 |
CNY 4840.00 |
|
| PH326157 | ITGB2 MS Standard C13 and N15-labeled recombinant protein (NP_001120963) |
CNY 14250.00 |

