Transketolase (TKT) (NM_001135055) Human Recombinant Protein
CAT＃: TP326037
Recombinant protein of human transketolase (TKT), transcript variant 2, 20 µg
View other "Transketolase" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226037 representing NM_001135055
Red=Cloning site Green=Tags(s) MESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKSQDPRNPHNDR FVLSKGHAAPILYAVWAEAGFLAEAELLNLRKISSDLDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGK YFDKASYRVYCLLGDGELSEGSVWEAMAFASIYKLDNLVAILDINRLGQSDPAPLQHQMDIYQKRCEAFG WHAIIVDGHSVEELCKAFGQAKHQPTAIIAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQS KKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKIATRKAYGQALAKLGHASDRIIALDGDTKNSTFSEI FKKEHPDRFIECYIAEQNMVSIAVGCATRNRTVPFCSTFAAFFTRAFDQIRMAAISESNINLCGSHCGVS IGEDGPSQMALEDLAMFRSVPTSTVFYPSDGVATEKAVELAANTKGICFIRTSRPENAIIYNNNEDFQVG QAKVVLKSKDDQVTVIGAGVTLHEALAAAELLKKEKINIRVLDPFTIKPLDRKLILDSARATKGRILTVE DHYYEGGIGEAVSSAVVGEPGITVTHLAVNRVPRSGKPAELLKMFGIDRDAIAQAVRGLITKA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 67.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001128527 |
| Locus ID | 7086 |
| UniProt ID | P29401 |
| Cytogenetics | 3p21.1 |
| Refseq ORF | 1869 |
| Synonyms | HEL-S-48; HEL107; SDDHD; TK; TKT1 |
| Summary | This gene encodes a thiamine-dependent enzyme which plays a role in the channeling of excess sugar phosphates to glycolysis in the pentose phosphate pathway. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Apr 2012] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Pentose phosphate pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400434 | TKT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427542 | TKT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400434 | Transient overexpression lysate of transketolase (TKT), transcript variant 1 |
CNY 3080.00 |
|
| LY427542 | Transient overexpression lysate of transketolase (TKT), transcript variant 2 |
CNY 3080.00 |
|
| PH303497 | TKT MS Standard C13 and N15-labeled recombinant protein (NP_001055) |
CNY 19520.00 |
|
| PH326037 | TKT MS Standard C13 and N15-labeled recombinant protein (NP_001128527) |
CNY 19520.00 |
|
| TP303497 | Recombinant protein of human transketolase (TKT), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Transketolase产品
