LYN (NM_001111097) Human Recombinant Protein
CAT#: TP325842
Purified recombinant protein of Homo sapiens v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 2, 20 µg
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC225842 representing NM_001111097 
Red=Cloning site Green=Tags(s) MGCIKSKGKDSLSDDGVDLKTQPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMK VLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETL KGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKP QKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDK LVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAA NVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGK IPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTFDYLQSVLDDFYTATEGQYQQQ P myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 55.9 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_001104567 | 
| Locus ID | 4067 | 
| UniProt ID | P07948 | 
| Cytogenetics | 8q12.1 | 
| Refseq ORF | 1473 | 
| Synonyms | JTK8; p53Lyn; p56Lyn | 
| Summary | This gene encodes a tyrosine protein kinase, which maybe involved in the regulation of mast cell degranulation, and erythroid differentiation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011] | 
| Protein Families | Druggable Genome, Protein Kinase | 
| Protein Pathways | B cell receptor signaling pathway, Chemokine signaling pathway, Epithelial cell signaling in Helicobacter pylori infection, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Long-term depression | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC426351 | LYN HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY426351 | Transient overexpression lysate of v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| PH325842 | LYN MS Standard C13 and N15-labeled recombinant protein (NP_001104567) | 
                                                     CNY 14250.00  | 
                                            |
| TP761921 | Purified recombinant protein of Human tyrosine-protein kinase Lyn isoform A (LYN), Gly8-Asp238, with N-terminal HIS tag, expressed in E. coli, 50ug | 
                                                     CNY 2040.00  | 
                                            
