ABLIM2 (NM_001130088) Human Recombinant Protein
CAT＃: TP325796
Recombinant protein of human actin binding LIM protein family, member 2 (ABLIM2), transcript variant 7, 20 µg
View other "ABLIM2" proteins (17)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC225796 representing NM_001130088
Red=Cloning site Green=Tags(s) MSAVSQPQAAPSPLEKSPSTAILCNTCGNVCKGEVLRVQDKYFHIKCFVCKACGCDLAEGGFFVRQGEYI CTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKCSLPVSV GSSAHLSQGLRSCGGCGTEIKNGQALVALDKHWHLGCFKCKSCGKLLNAEYISKDGLPYCEADYHAKFGI RCDSCEKYITGRVLEAGEKHYHPSCALCVRCGQMFAEGEEMYLQGSSIWHPACRQAARTEDRNKETRTSS ESIISVPASSTSGSPSRVIYAKLGGEILDYRDLAALPKSKAIYDIDRPDMISYSPYISHSAGDRQSYGES PQLLSPTPTEGDQDDRSYKQCRTSSPSSTGSVSLGRYTPTSRSPQHYSRPAARRSDGEDGSLDQDNRKQK SSWLMLKGDADTRTNSPDLDTQSLSHSSGTDRDPLQRMAGDSFHSREWFF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 51.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001123560 |
| Locus ID | 84448 |
| UniProt ID | Q6H8Q1 |
| Cytogenetics | 4p16.1 |
| Refseq ORF | 1410 |
| Summary | May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity.[UniProtKB/Swiss-Prot Function] |
| Protein Pathways | Axon guidance |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410126 | ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC427151 | ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427152 | ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427153 | ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427154 | ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427155 | ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427156 | ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410126 | Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 6 |
CNY 4840.00 |
|
| LY427151 | Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 1 |
CNY 3080.00 |
|
| LY427152 | Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 2 |
CNY 3080.00 |
|
| LY427153 | Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 3 |
CNY 3080.00 |
|
| LY427154 | Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 4 |
CNY 3080.00 |
|
| LY427155 | Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 5 |
CNY 3080.00 |
|
| LY427156 | Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 7 |
CNY 3080.00 |
|
| PH325796 | ABLIM2 MS Standard C13 and N15-labeled recombinant protein (NP_001123560) |
CNY 14250.00 |
|
| PH326056 | ABLIM2 MS Standard C13 and N15-labeled recombinant protein (NP_001123555) |
CNY 14250.00 |
|
| TP326056 | Purified recombinant protein of Homo sapiens actin binding LIM protein family, member 2 (ABLIM2), transcript variant 1, 20 µg |
CNY 2900.00 |
