Neuro D4 (DPF1) (NM_001135155) Human Recombinant Protein
CAT#: TP325651
Recombinant protein of human D4, zinc and double PHD fingers family 1 (DPF1), transcript variant 1, 20 µg
View other "Neuro D4" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC225651 representing NM_001135155
Red=Cloning site Green=Tags(s) MGGLSARPTAGRTDPAGTCWGQDPGSKMATVIPGPLSLGEDFYREAIEHCRSYNARLCAERSLRLPFLDS QTGVAQNNCYIWMEKTHRGPGLAPGQIYTYPARCWRKKRRLNILEDPRLRPCEYKIDCEAPLKKEGGLPE GPVLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLRKRQ DTASLEDRDKPYVCDICGKRYKNRPGLSYHYTHTHLAEEEGEENAERHALPFHRKNNHKQFYKELAWVPE AQRKHTAKKAPDGTVIPNGYCDFCLGGSKKTGCPEDLISCADCGRSGHPSCLQFTVNMTAAVRTYRWQCI ECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLCLRHLKEKASAYITLT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 46.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001128627 |
| Locus ID | 8193 |
| UniProt ID | Q92782 |
| Cytogenetics | 19q13.2 |
| Refseq ORF | 1242 |
| Synonyms | BAF45b; NEUD4; neuro-d4 |
| Summary | May have an important role in developing neurons by participating in regulation of cell survival, possibly as a neurospecific transcription factor. Belongs to the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC427564 | DPF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432205 | DPF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY427564 | Transient overexpression lysate of D4, zinc and double PHD fingers family 1 (DPF1), transcript variant 1 |
CNY 3080.00 |
|
| LY432205 | Transient overexpression lysate of D4, zinc and double PHD fingers family 1 (DPF1), transcript variant 2 |
CNY 3080.00 |
|
| PH325651 | DPF1 MS Standard C13 and N15-labeled recombinant protein (NP_001128627) |
CNY 19520.00 |
其它Neuro D4产品
