SYNPR (NM_001130003) Human Recombinant Protein
CAT#: TP325395
Purified recombinant protein of Homo sapiens synaptoporin (SYNPR), transcript variant 1, 20 µg
View other "SYNPR" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC225395 representing NM_001130003
Red=Cloning site Green=Tags(s) MDPVSQLASAGTFRVLKEPLAFLRALELLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFR LHQVTFEVPTCEGKERQKLALIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV TVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSVVFGFLNFILW AGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTS FTNQI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001123475 |
| Locus ID | 132204 |
| UniProt ID | Q8TBG9 |
| Cytogenetics | 3p14.2 |
| Refseq ORF | 855 |
| Synonyms | SPO |
| Summary | Intrinsic membrane protein of small synaptic vesicles. Probable vesicular channel protein (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403401 | SYNPR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427094 | SYNPR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403401 | Transient overexpression lysate of synaptoporin (SYNPR), transcript variant 2 |
CNY 3080.00 |
|
| LY427094 | Transient overexpression lysate of synaptoporin (SYNPR), transcript variant 1 |
CNY 3080.00 |
|
| PH305424 | SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_653243) |
CNY 19520.00 |
|
| PH325395 | SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_001123475) |
CNY 14250.00 |
|
| TP305424 | Recombinant protein of human synaptoporin (SYNPR), transcript variant 2, 20 µg |
CNY 2900.00 |
