C7orf46 (FAM221A) (NM_001127364) Human Recombinant Protein
CAT#: TP325356
Recombinant protein of human chromosome 7 open reading frame 46 (C7orf46), transcript variant 2, 20 µg
View other "C7orf46" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225356 representing NM_001127364
Red=Cloning site Green=Tags(s) MERLTLPLGGAAAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKRKVLPLRLQNRLFVSWRSPTGMDCKLVG PETLCFCTHRYKQHKTDLEAIPQQCPIDLPCQVTGCQCRAYLYVPLNGSQPIRCRCKHFADQHSAAPGFT CNTCSKCSGFHSCFTCACGQPAYAHDTVVETKQERLAQEKPVGQDIPYAAMGGLTGFSSLAEGYMRLDDS GIVGTSSQVSSLRRPEEDDMAFFERRYQERMKMEKAAKWKGKAPLPSATKPS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001120836 |
Locus ID | 340277 |
UniProt ID | A4D161 |
Cytogenetics | 7p15.3 |
Refseq ORF | 786 |
Synonyms | C7orf46 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404748 | FAM221A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426758 | FAM221A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426759 | FAM221A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404748 | Transient overexpression lysate of chromosome 7 open reading frame 46 (C7orf46), transcript variant 1 |
CNY 3080.00 |
|
LY426758 | Transient overexpression lysate of chromosome 7 open reading frame 46 (C7orf46), transcript variant 2 |
CNY 3080.00 |
|
LY426759 | Transient overexpression lysate of chromosome 7 open reading frame 46 (C7orf46), transcript variant 3 |
CNY 3080.00 |
|
PH325356 | C7orf46 MS Standard C13 and N15-labeled recombinant protein (NP_001120836) |
CNY 14250.00 |
|
TP760985 | Purified recombinant protein of Human chromosome 7 open reading frame 46 (C7orf46), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它C7orf46产品