STYX (NM_001130701) Human Recombinant Protein
CAT#: TP325273
Recombinant protein of human serine/threonine/tyrosine interacting protein (STYX), transcript variant 2, 20 µg
View other "STYX" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225273 protein sequence
Red=Cloning site Green=Tags(s) MEDVKLEFPSLPQCKEDAEEWTYPMRREMQEILPGLFLGPYSSAMKSKLPVLQKHGITHIICIRQNIEAN FIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEFIDGSLQMGGKVLVHGNAGISRSAAFVIAYIMETFG MKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLAKLTIQMMSPLQIERSLSVHSGTTGSLKRTHEEED DFGTMQVATAQNG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001124173 |
Locus ID | 6815 |
UniProt ID | Q8WUJ0 |
Refseq Size | 4631 |
Cytogenetics | 14q22.1 |
Refseq ORF | 669 |
Summary | The protein encoded by this gene is a pseudophosphatase, able to bind potential substrates but lacking an active catalytic loop. The encoded protein may be involved in spermiogenesis. Two transcript variants encoding the same protein have been found for these genes. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407985 | STYX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427250 | STYX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407985 | Transient overexpression lysate of serine/threonine/tyrosine interacting protein (STYX), transcript variant 1 |
CNY 3080.00 |
|
LY427250 | Transient overexpression lysate of serine/threonine/tyrosine interacting protein (STYX), transcript variant 2 |
CNY 3080.00 |
|
PH302205 | STYX MS Standard C13 and N15-labeled recombinant protein (NP_660294) |
CNY 19520.00 |
|
PH325273 | STYX MS Standard C13 and N15-labeled recombinant protein (NP_001124173) |
CNY 19520.00 |
|
TP302205 | Recombinant protein of human serine/threonine/tyrosine interacting protein (STYX), transcript variant 1, 20 µg |
CNY 2900.00 |