PRR20D (NM_001130406) Human Recombinant Protein
CAT#: TP325268
Purified recombinant protein of Homo sapiens FLJ40296 protein family member (LOC729246), 20 µg
View other "PRR20D" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225268 representing NM_001130406
Red=Cloning site Green=Tags(s) MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRRQPPARPESPP PAERGRRRGGSRRPGRGRGRRAGPRGDAGQRQGAEGLMAPDVHIQLDHHGEPGHQGEPEITETAAFSLSE TGPPPGTVQEGPGPDVAQPELGFQEPPAAPGPQAVDWQPVLTLYPCIGFRALGDSAVLQVIQTPQGTYVQ GVPVFLTDIAY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001123878 |
Locus ID | 729246 |
UniProt ID | P86496 |
Cytogenetics | 13q21.1 |
Refseq ORF | 663 |
Synonyms | PRR20; PRR20A; PRR20B; PRR20C; PRR20E |
Summary | This gene is one of five identical loci in a cluster on chromosome 13q21.1. The predicted protein is proline-rich and contains several dopamine D4 receptor signatures and PRINTS domains. [provided by RefSeq, Oct 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC427200 | PRR20D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY427200 | Transient overexpression lysate of proline rich 20D (PRR20D) |
CNY 3080.00 |
|
PH325268 | PRR20D MS Standard C13 and N15-labeled recombinant protein (NP_001123878) |
CNY 14250.00 |