CSRP3 (NM_001127656) Human Recombinant Protein
CAT#: TP325217
Recombinant protein of human cysteine and glycine-rich protein 3 (cardiac LIM protein) (CSRP3), transcript variant 2, 20 µg
View other "CSRP3" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225217 protein sequence
Red=Cloning site Green=Tags(s) MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRRYGPKG IGYGQGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGKSVYAAEKVMGGGKPW HKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTQQVEKKE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Enzyme substrate (PMID: 27281159) Binding assay (PMID: 27281159) Co-immunoprecipitation (PMID: 27281159) |
Reference Data | |
RefSeq | NP_001121128 |
Locus ID | 8048 |
UniProt ID | P50461 |
Refseq Size | 1464 |
Cytogenetics | 11p15.1 |
Refseq ORF | 582 |
Synonyms | CLP; CMD1M; CMH12; CRP3; LMO4; MLP |
Summary | This gene encodes a member of the CSRP family of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this protein is found in a group of proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Mutations in this gene are thought to cause heritable forms of hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM) in humans. Alternatively spliced transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene. [provided by RefSeq, Jul 2008] |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Glomerular filtrate proteins in acute cardiorenal syndrome
,Wakasaki, R;Matsushita, K;Golgotiu, K;Anderson, S;Eiwaz, MB;Orton, DJ;Han, SJ;Lee, HT;Smith, RD;Rodland, KD;Piehowski, PD;Hutchens, MP;,
JCI Insight
,PubMed ID 30829647
[CSRP3]
|
Aberrant Glycosylation in the Left Ventricle and Plasma of Rats with Cardiac Hypertrophy and Heart Failure
,Nagai-Okatani, C;Minamino, N;,
PLoS ONE
,PubMed ID 27281159
[CSRP3]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418660 | CSRP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426837 | CSRP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418660 | Transient overexpression lysate of cysteine and glycine-rich protein 3 (cardiac LIM protein) (CSRP3), transcript variant 1 |
CNY 3080.00 |
|
LY426837 | Transient overexpression lysate of cysteine and glycine-rich protein 3 (cardiac LIM protein) (CSRP3), transcript variant 2 |
CNY 3080.00 |
|
PH325217 | CSRP3 MS Standard C13 and N15-labeled recombinant protein (NP_001121128) |
CNY 19520.00 |