C1orf194 (NM_001122961) Human Recombinant Protein
CAT#: TP325142
Recombinant protein of human chromosome 1 open reading frame 194 (C1orf194), 20 µg
View other "C1orf194" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC225142 representing NM_001122961
Red=Cloning site Green=Tags(s) MERSPSRRRRLEEAPKLPYKNPTHLAQQQEPWSRLNSTPTITSMRRDAYYFDPEIPKDDLDFRLAALYNH HTGTFKNKSEILLNQKTTQDTYRTKIQFPGEFLTPPTPPITFLANIRHWINPKKESIHSIQGSIVSPHTA ATNGGYSRKKDGGFFST myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 17.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001116433 |
| Locus ID | 127003 |
| UniProt ID | Q5T5A4 |
| Cytogenetics | 1p13.3 |
| Refseq ORF | 471 |
| Summary | May play an important role for the maintenance of myelin-axon integrity (By similarity). May affect intracellular Ca(2+) homeostasis (PubMed:31199454).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC426588 | C1orf194 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY426588 | Transient overexpression lysate of chromosome 1 open reading frame 194 (C1orf194) |
CNY 3080.00 |
|
| PH325142 | C1orf194 MS Standard C13 and N15-labeled recombinant protein (NP_001116433) |
CNY 19520.00 |
其它C1orf194产品
