YPEL5 (NM_001127401) Human Recombinant Protein
CAT#: TP325061
Purified recombinant protein of Homo sapiens yippee-like 5 (Drosophila) (YPEL5), transcript variant 1, 20 µg
View other "YPEL5" proteins (15)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC225061 protein sequence
Red=Cloning site Green=Tags(s) MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRD VSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 13.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001120873 |
| Locus ID | 51646 |
| UniProt ID | P62699 |
| Refseq Size | 2639 |
| Cytogenetics | 2p23.1 |
| Refseq ORF | 363 |
| Synonyms | CGI-127 |
| Summary | Component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1 (PubMed:29911972). Required for normal cell proliferation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402494 | YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426781 | YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426782 | YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426783 | YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402494 | Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 4 |
CNY 3080.00 |
|
| LY426781 | Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 3 |
CNY 3080.00 |
|
| LY426782 | Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 2 |
CNY 3080.00 |
|
| LY426783 | Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 1 |
CNY 3080.00 |
|
| PH301463 | YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_057145) |
CNY 14250.00 |
|
| PH325059 | YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120871) |
CNY 14250.00 |
|
| PH325060 | YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120872) |
CNY 14250.00 |
|
| PH325061 | YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120873) |
CNY 14250.00 |
|
| TP301463 | Recombinant protein of human yippee-like 5 (Drosophila) (YPEL5), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP325059 | Purified recombinant protein of Homo sapiens yippee-like 5 (Drosophila) (YPEL5), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP325060 | Purified recombinant protein of Homo sapiens yippee-like 5 (Drosophila) (YPEL5), transcript variant 2, 20 µg |
CNY 2900.00 |
