CEACAM16 (NM_001039213) Human Recombinant Protein
CAT#: TP324965
Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 16 (CEACAM16), 20 µg
View other "CEACAM16" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC224965 representing NM_001039213
Red=Cloning site Green=Tags(s) MSDLLSIYSAPVVVSTVLHMLQIRKLRLGRVHKLPRVLEVGNSGTMSRAYTFFFLRWSFMALTGYSWLLL SATFLNVGAEISITLEPAQPSEGDNVTLVVHGLSGELLAYSWYAGPTLSVSYLVASYIVSTGDETPGPAH TGREAVRPDGSLDIQGILPRHSGTYILQTFNRQLQTEVGYGHVQVHEILAQPTVLANSTALVERRDTLRL MCSSPSPTAEVRWFFNGGALPVALRLGLSPDGRVLARHGIRREEAGAYQCEVWNPVSVSRSEPINLTVYF GPERVAILQDSTTRTGCTIKVDFNTSLTLWCVSRSCPEPEYVWTFNGQALKNGQDHLNISSMTAAQEGTY TCIAKNTKTLLSGSASVVVKLSAAAVATMIVPVPTKPTEGQDVTLTVQGYPKDLLVYAWYRGPASEPNRL LSQLPSGTWIAGPAHTGREVGFPNCSLLVQKLNLTDTGRYTLKTVTVQGKTETLEVELQVAPLG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 45.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001034302 |
| Locus ID | 388551 |
| UniProt ID | Q2WEN9 |
| Refseq Size | 1797 |
| Cytogenetics | 19q13.31-q13.32 |
| Refseq ORF | 1452 |
| Synonyms | CEAL2; DFNA4B; DFNB113 |
| Summary | The protein encoded by this gene is a secreted glycoprotein that in mouse interacts with tectorial membrane proteins in the inner ear. The encoded adhesion protein is found in cochlear outer hair cells and appears to be important for proper hearing over an extended frequency range. Defects in this gene likely are a cause of non-syndromic autosomal dominant hearing loss. [provided by RefSeq, May 2012] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422030 | CEACAM16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY422030 | Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 16 (CEACAM16) |
CNY 4840.00 |
|
| PH324965 | CEACAM16 MS Standard C13 and N15-labeled recombinant protein (NP_001034302) |
CNY 19520.00 |
其它CEACAM16产品
