ICEBERG (CARD18) (NM_021571) Human Recombinant Protein
CAT#: TP324896
Recombinant protein of human caspase recruitment domain family, member 18 (CARD18), 20 µg
View other "ICEBERG" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224896 representing NM_021571
Red=Cloning site Green=Tags(s) MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCC KFIKHLCEEDPQLASKMGLH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_067546 |
Locus ID | 59082 |
UniProt ID | P57730 |
Refseq Size | 431 |
Cytogenetics | 11q22.3 |
Refseq ORF | 270 |
Synonyms | ICEBERG; pseudo-ICE; UNQ5804 |
Summary | Inhibits generation of IL-1-beta by interacting with caspase-1 and preventing its association with RIP2. Down-regulates the release of IL1B.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | NOD-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411985 | CARD18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411985 | Transient overexpression lysate of caspase recruitment domain family, member 18 (CARD18) |
CNY 3080.00 |
|
PH324896 | CARD18 MS Standard C13 and N15-labeled recombinant protein (NP_067546) |
CNY 19520.00 |
其它ICEBERG产品