TAL2 (NM_005421) Human Recombinant Protein
CAT#: TP324692
Recombinant protein of human T-cell acute lymphocytic leukemia 2 (TAL2), 20 µg
View other "TAL2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC224692 protein sequence
Red=Cloning site Green=Tags(s) MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAA QGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 12.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005412 |
| Locus ID | 6887 |
| UniProt ID | Q16559 |
| Refseq Size | 656 |
| Cytogenetics | 9q31.2 |
| Refseq ORF | 324 |
| Summary | This intronless gene encodes a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-cell acute lymphoblastic leukemia. [provided by RefSeq, Mar 2009] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417315 | TAL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417315 | Transient overexpression lysate of T-cell acute lymphocytic leukemia 2 (TAL2) |
CNY 3080.00 |
|
| PH324692 | TAL2 MS Standard C13 and N15-labeled recombinant protein (NP_005412) |
CNY 19520.00 |
