BLOC1S1 (NM_001487) Human Recombinant Protein

CAT#: TP324412L

Recombinant protein of human biogenesis of lysosomal organelles complex-1, subunit 1 (BLOC1S1), 1 mg

Size: 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 36000.00


货期*
4周

规格
    • 1 mg

Product images

推荐一起购买 (2)
Rabbit Polyclonal Anti-BLOC1S1 Antibody
    • 100 ul

CNY 5250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC224412 protein sequence
Red=Cloning site Green=Tags(s)

MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQF
AKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001478
Locus ID 2647
UniProt ID P78537
Refseq Size 590
Cytogenetics 12q13.2
Refseq ORF 375
Synonyms BLOS1; BORCS1; GCN5L1; MICoA; RT14
Summary BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and Dell'Angelica, 2004 [PubMed 15102850]).[supplied by OMIM, Mar 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...