GIPC (GIPC1) (NM_202468) Human Recombinant Protein
CAT#: TP324373L
Recombinant protein of human GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 3, 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC224373 protein sequence
Red=Cloning site Green=Tags(s) MPLGLGRRKKAPPLVENEEAEPGRGGLGVGEPGPLGGGGSGGPQMGLPPPPPALRPRLVFHTQLAHGSPT GRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSE DALGLTITDNGAGYAFIKRIKEGSVIDHIHLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLK LTEPRKAFDMISQRSAGGRPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRD TELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_974197 |
| Locus ID | 10755 |
| UniProt ID | O14908 |
| Refseq Size | 1908 |
| Cytogenetics | 19p13.12 |
| Refseq ORF | 999 |
| Synonyms | C19orf3; GIPC; GLUT1CBP; Hs.6454; IIP-1; NIP; OPDM2; RGS19IP1; SEMCAP; SYNECTIIN; SYNECTIN; TIP-2 |
| Summary | GIPC1 is a scaffolding protein that regulates cell surface receptor expression and trafficking (Lee et al., 2008 [PubMed 18775991]).[supplied by OMIM, Apr 2009] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
