TCF4 (NM_001083962) Human Recombinant Protein
CAT#: TP324345
Recombinant protein of human transcription factor 4 (TCF4), transcript variant 1, 20 µg
View other "TCF4" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC224345 representing NM_001083962
Red=Cloning site Green=Tags(s) MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWGNGGHPSPSRN YGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCHQQSLLGGDMDMGNPGTLS PTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGYPSSKPATST FPSSFFMQDGHHSSDPWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPM STFHRSGTNHYSTSSCTPPANGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVG SPPSLSAGTAVWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHG IIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPP QDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITRSRSSNNDDEDLTPE QKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNL NPKAACLKRREEEKVSSEPPPLSLAGPHPGMGDASNHMGQM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 71.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001077431 |
| Locus ID | 6925 |
| UniProt ID | P15884 |
| Refseq Size | 8332 |
| Cytogenetics | 18q21.2 |
| Refseq ORF | 2013 |
| Synonyms | bHLHb19; CDG2T; E2-2; FECD3; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4 |
| Summary | This gene encodes transcription factor 4, a basic helix-loop-helix transcription factor. The encoded protein recognizes an Ephrussi-box ('E-box') binding site ('CANNTG') - a motif first identified in immunoglobulin enhancers. This gene is broadly expressed, and may play an important role in nervous system development. Defects in this gene are a cause of Pitt-Hopkins syndrome. In addition, an intronic CTG repeat normally numbering 10-37 repeat units can expand to >50 repeat units and cause Fuchs endothelial corneal dystrophy. Multiple alternatively spliced transcript variants that encode different proteins have been described. [provided by RefSeq, Jul 2016] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401106 | TCF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC421261 | TCF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY401106 | Transient overexpression lysate of transcription factor 4 (TCF4), transcript variant 2 |
CNY 4840.00 |
|
| LY421261 | Transient overexpression lysate of transcription factor 4 (TCF4), transcript variant 1 |
CNY 4840.00 |
|
| PH317718 | TCF4 MS Standard C13 and N15-labeled recombinant protein (NP_003190) |
CNY 19520.00 |
|
| PH324345 | TCF4 MS Standard C13 and N15-labeled recombinant protein (NP_001077431) |
CNY 19520.00 |
|
| TP317718 | Recombinant protein of human transcription factor 4 (TCF4), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP760702 | Purified recombinant protein of Human transcription factor 4 (TCF4), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |

