PD L2 (PDCD1LG2) (NM_025239) Human Recombinant Protein
CAT#: TP324141
Recombinant protein of human programmed cell death 1 ligand 2 (PDCD1LG2), 20 µg
View other "PD L2" proteins (6)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC224141 representing NM_025239 
Red=Cloning site Green=Tags(s) MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHR ERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVE LTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQ SQMEPRTHPTWLLHIFIPSCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 30.8 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_079515 | 
| Locus ID | 80380 | 
| UniProt ID | Q9BQ51 | 
| Refseq Size | 1518 | 
| Cytogenetics | 9p24.1 | 
| Refseq ORF | 819 | 
| Synonyms | B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2 | 
| Summary | Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production (By similarity).[UniProtKB/Swiss-Prot Function] | 
| Protein Families | Transmembrane | 
| Protein Pathways | Cell adhesion molecules (CAMs) | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC410802 | PDCD1LG2 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY410802 | Transient overexpression lysate of programmed cell death 1 ligand 2 (PDCD1LG2) | 
                                                     CNY 3080.00  | 
                                            |
| PH324141 | PDCD1LG2 MS Standard C13 and N15-labeled recombinant protein (NP_079515) | 
                                                     CNY 19520.00  | 
                                            |
| TP700202 | Purified recombinant protein of human programmed cell death 1 ligand 2 (PDCD1LG2), extracellular domain expressed in human cells, 20 µg | 
                                                     CNY 6650.00  | 
                                            |
| TP700203 | Purified recombinant protein of human programmed cell death 1 ligand 2 (PDCD1LG2), extracellular domain with C-terminal Fc fusion, expressed in human cells, 20 µg | 
                                                     CNY 6650.00  | 
                                            |
| TP720737 | Purified recombinant protein of Human programmed cell death 1 ligand 2 (PDCD1LG2) | 
                                                     CNY 1800.00  | 
                                            
