OCM2 (NM_006188) Human Recombinant Protein
CAT#: TP324075
Recombinant protein of human oncomodulin 2 (OCM2), 20 µg
View other "OCM2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224075 protein sequence
Red=Cloning site Green=Tags(s) MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQK FESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006179 |
Locus ID | 4951 |
UniProt ID | P0CE71 |
Refseq Size | 588 |
Cytogenetics | 7q21.3 |
Refseq ORF | 327 |
Synonyms | OCM; OM |
Summary | This gene is similar to the oncomodulin gene, a high-affinity calcium ion-binding protein that belongs to the superfamily of calmodulin proteins, also known as the EF-hand proteins. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |