PQBP1 (NM_001032382) Human Recombinant Protein
CAT#: TP323994
Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 3, 20 µg
View other "PQBP1" proteins (22)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223994 protein sequence
Red=Cloning site Green=Tags(s) MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADT DLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDR DRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYS DAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 30.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001027554 |
| Locus ID | 10084 |
| UniProt ID | O60828 |
| Refseq Size | 1082 |
| Cytogenetics | Xp11.23 |
| Refseq ORF | 795 |
| Synonyms | MRX2; MRX55; MRXS3; MRXS8; NPW38; RENS1; SHS |
| Summary | This gene encodes a nuclear polyglutamine-binding protein that is involved with transcription activation. The encoded protein contains a WW domain. Mutations in this gene have been found in patients with Renpenning syndrome 1 and other syndromes with X-linked cognitive disability. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.[provided by RefSeq, Nov 2009] |
| Protein Families | Transcription Factors |
| Protein Pathways | Spliceosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417119 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422317 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422318 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422319 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422320 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432617 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417119 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 1 |
CNY 3080.00 |
|
| LY422317 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 2 |
CNY 3080.00 |
|
| LY422318 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 3 |
CNY 3080.00 |
|
| LY422319 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 4 |
CNY 3080.00 |
|
| LY422320 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 5 |
CNY 3080.00 |
|
| LY432617 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 10 |
CNY 3080.00 |
|
| PH304269 | PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027553) |
CNY 14250.00 |
|
| PH321161 | PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027556) |
CNY 14250.00 |
|
| PH323943 | PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_005701) |
CNY 19520.00 |
|
| PH323994 | PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027554) |
CNY 14250.00 |
|
| PH324043 | PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027555) |
CNY 14250.00 |
|
| TP304269 | Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP321161 | Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 5, 20 µg |
CNY 2900.00 |
|
| TP323943 | Recombinant protein of human polyglutamine binding protein 1 (PQBP1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP324043 | Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP329617 | Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 10, 20 µg |
CNY 2900.00 |
