ACCN5 (ASIC5) (NM_017419) Human Recombinant Protein
CAT#: TP323871
Recombinant protein of human amiloride-sensitive cation channel 5, intestinal (ACCN5), 20 µg
View other "ACCN5" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223871 representing NM_017419
Red=Cloning site Green=Tags(s) MEQTEKSKVYAENGLLEKIKLCPSKKPLPSPTERKKFDYDFAISTSFHGIHNIVQNRSKIRRVLWLVVVL GSVSLVTWQIYIRLLNYFTWPTTASIEVQYVEKMEFPTVTFCNLNRFQTDAVAKFGVIFFLWHIVSKVLH LQEITANSTGSREATDFAASHQNFSIVEFIRNKGFYLNNSTLLDCEFFGKPCSPKDFAHVFTEYGNCFTF NHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVDAGIIFVIHSPKKVPQFDGLGLLSPVGMHAR VTIRQVKTVHQEYPWGECNPNIKLQNFSSYSTSGCLKECKAQHIKKQCGCVPFLLPGYGIECDLQKYFSC VSPVLDHIEFKDLCTVGTHNSSCPVSCEEIEYPATISYSSFPSQKALKYLSKKLNQSRKYIRENLVKIEI NYSDLNYKITQQQKAVSVSELLADLGGQLGLFCGASLITIIEIIEYLFTNFYWICIFFLLKISEMTQWTP PPQNHLGNKNRIEEC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 57.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_059115 |
| Locus ID | 51802 |
| UniProt ID | Q9NY37 |
| Refseq Size | 1692 |
| Cytogenetics | 4q32.1 |
| Refseq ORF | 1515 |
| Synonyms | ACCN5; HINAC; INAC |
| Summary | This gene belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413777 | ASIC5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY413777 | Transient overexpression lysate of amiloride-sensitive cation channel 5, intestinal (ACCN5) |
CNY 4840.00 |
|
| PH323871 | ACCN5 MS Standard C13 and N15-labeled recombinant protein (NP_059115) |
CNY 14250.00 |
