C1QL3 (NM_001010908) Human Recombinant Protein
CAT#: TP323500
Purified recombinant protein of Homo sapiens complement component 1, q subcomponent-like 3 (C1QL3), 20 µg
View other "C1QL3" proteins (2)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223500 representing NM_001010908
Red=Cloning site Green=Tags(s) MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPG KAGPRGPPGEPGPPGPMGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGY EVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNY DYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001010908 |
Locus ID | 389941 |
UniProt ID | Q5VWW1 |
Refseq Size | 2493 |
Cytogenetics | 10p13 |
Refseq ORF | 765 |
Synonyms | C1ql; C1QTNF13; CTRP13; K100 |
Summary | May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses (By similarity). Plays a role in glucose homeostasis. Via AMPK signaling pathway, stimulates glucose uptake in adipocytes, myotubes and hepatocytes and enhances insulin-stimulated glucose uptake. In a hepatoma cell line, reduces the expression of gluconeogenic enzymes G6PC and PCK1 and hence decreases de novo glucose production (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
PH323500 | C1QL3 MS Standard C13 and N15-labeled recombinant protein (NP_001010908) |
CNY 14250.00 |
|
TP701110 | Purified recombinant protein of Human complement component 1, q subcomponent-like 3 (C1QL3), His21-End, with C-terminal His tag, secretory expressed in HEK293 cells, 50 ug |
CNY 7490.00 |