Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) (NM_001011725) Human Recombinant Protein
CAT＃: TP323427
Recombinant protein of human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 2, 20 µg
View other "Heterogeneous Nuclear Ribonucleoprotein (A1 like)" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223427 representing NM_001011725
Red=Cloning site Green=Tags(s) MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDA AMNTTPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDR GSGKKRGFAFVTFDDHDSVDKIVIQKYHTVKGHNCEVRKALPKQEMASASSSQRGRRGSGNFGGGRGDGF GGNDNFGRGGNFSGRGGFGGSCGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGN FGGRSSGPYGGGGQYFAKPQNQGGYGVSSSSSSYGSGRRF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 34 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001011725 |
| Locus ID | 144983 |
| UniProt ID | Q32P51 |
| Refseq Size | 2224 |
| Cytogenetics | 13q14.3 |
| Refseq ORF | 960 |
| Summary | Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection.[UniProtKB/Swiss-Prot Function] |
| Protein Pathways | Spliceosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423305 | HNRNPA1L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423306 | HNRNPA1L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423305 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1 |
CNY 3080.00 |
|
| LY423306 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 2 |
CNY 3080.00 |
|
| PH318191 | HNRNPA1L2 MS Standard C13 and N15-labeled recombinant protein (NP_001011724) |
CNY 14250.00 |
|
| PH323427 | HNRNPA1L2 MS Standard C13 and N15-labeled recombinant protein (NP_001011725) |
CNY 19520.00 |
|
| TP318191 | Purified recombinant protein of Homo sapiens heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Heterogeneous Nuclear Ribonucleoprotein (A1 like)产品
