PRLH (NM_015893) Human Recombinant Protein
CAT#: TP323400
Recombinant protein of human prolactin releasing hormone (PRLH), 20 µg
View other "PRLH" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223400 protein sequence
Red=Cloning site Green=Tags(s) MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATLGDVPKPGLRP RLTCFPLEGGAMSSQDG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056977 |
Locus ID | 51052 |
UniProt ID | P81277 |
Refseq Size | 264 |
Cytogenetics | 2q37.3 |
Refseq ORF | 263 |
Synonyms | PRH; PRRP |
Summary | Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL.[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414287 | PRLH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414287 | Transient overexpression lysate of prolactin releasing hormone (PRLH) |
CNY 3080.00 |
|
PH323400 | PRLH MS Standard C13 and N15-labeled recombinant protein (NP_056977) |
CNY 19520.00 |