ABCE1 (NM_002940) Human Recombinant Protein
CAT#: TP323295
Recombinant protein of human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1, 20 µg
View other "ABCE1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223295 representing NM_002940
Red=Cloning site Green=Tags(s) MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCGICIKKCPFGAL SIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDW QEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIVCQQLDLTHLK ERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINPDRYIIVVEHDLSVLD YLSDFICCLYGVPSAYGVVTMPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKY PGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKS TGSVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVALALCLGKPADVYLIDEPSA YLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLS QLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 67.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002931 |
| Locus ID | 6059 |
| UniProt ID | P61221 |
| Refseq Size | 3568 |
| Cytogenetics | 4q31.21 |
| Refseq ORF | 1797 |
| Synonyms | ABC38; OABP; RLI; RLI1; RNASEL1; RNASELI; RNS4I |
| Summary | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401029 | ABCE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420840 | ABCE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401029 | Transient overexpression lysate of ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1 |
CNY 3080.00 |
|
| LY420840 | Transient overexpression lysate of ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2 |
CNY 3080.00 |
|
| PH323295 | ABCE1 MS Standard C13 and N15-labeled recombinant protein (NP_002931) |
CNY 19520.00 |
