Dysbindin (DTNBP1) (NM_183041) Human Recombinant Protein
CAT#: TP323289
Recombinant protein of human dystrobrevin binding protein 1 (DTNBP1), transcript variant 3, 20 µg
View other "Dysbindin" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223289 representing NM_183041
Red=Cloning site Green=Tags(s) MLETLRERLLSVQQDFTSGLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELLSRYEDTWAALHRRAKDCA SAGELVDSEVVMLSAHWEKKKTSLVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCG QCELERCKHMQSQQLENYKKNKRKELETFKAELDAEHAQKVLEMEHTQQMKLKERQKFFEEAFQQDMEQY LSTGYLQIAERREPIGSMSSMEVNVDMLEQMDLMDISDQEALDVFLNSGGEENTVLSPALGPESSTCQNE ITLQVPNPSELRAKPPSSSSTCTDSATRDISEGGESPVVQSDEEEVQVDTALATSHTDREATPDGGEDSD S myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_898862 |
Locus ID | 84062 |
UniProt ID | Q96EV8 |
Refseq Size | 1509 |
Cytogenetics | 6p22.3 |
Refseq ORF | 813 |
Synonyms | DBND; DKFZp564K192; dysbindin; dystrobrevin binding protein 1; FLJ30031; HPS7; MGC20210; My031; OTTHUMP00000016062; SDY |
Summary | This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. A similar protein in mouse is a component of a protein complex termed biogenesis of lysosome-related organelles complex 1 (BLOC-1), and binds to alpha- and beta-dystrobrevins, which are components of the dystrophin-associated protein complex (DPC). Mutations in this gene are associated with Hermansky-Pudlak syndrome type 7. This gene may also be associated with schizophrenia. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403167 | DTNBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405212 | DTNBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403167 | Transient overexpression lysate of dystrobrevin binding protein 1 (DTNBP1), transcript variant 1 |
CNY 3080.00 |
|
LY405212 | Transient overexpression lysate of dystrobrevin binding protein 1 (DTNBP1), transcript variant 2 |
CNY 3080.00 |
|
PH304208 | DTNBP1 MS Standard C13 and N15-labeled recombinant protein (NP_115498) |
CNY 19520.00 |
|
TP304208 | Recombinant protein of human dystrobrevin binding protein 1 (DTNBP1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP761501 | Purified recombinant protein of Human dystrobrevin binding protein 1 (DTNBP1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它Dysbindin产品