Matrin 3 (MATR3) (NM_018834) Human Recombinant Protein
CAT#: TP323258
Recombinant protein of human matrin 3 (MATR3), transcript variant 2, 20 µg
View other "Matrin 3" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223258 representing NM_018834
Red=Cloning site Green=Tags(s) MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTARLASLMNLGMSSSLNQQGAH SALSSASTSSHNLQSIFNIGSRGPLPLSSQHRGDADQASNILASFGLSARDLDELSRYPEDKITPENLPQ ILLQLKRRRTEEGPTLSYGRDGRSATREPPYRVPRDDWEEKRHFRRDSFDDRGPSLNPVLDYDHGSRSQE SGYYDRMDYEDDRLRDGERCRDDSFFGETSHNYHKFDSEYERMGRGPGPLQERSLFEKKRGAPPSSNIED FHGLLPKGYPHLCSICDLPVHSNKEWSQHINGASHSRRCQLLLEIYPEWNPDNDTGHTMGDPFMLQQSTN PAPGILGPPPPSFHLGGPAVGPRGNLGAGNGNLQGPRHMQKGRVETSRVVHIMDFQRGKNLRYQLLQLVE PFGVISNHLILNKINEAFIEMATTEDAQAAVDYYTTTPALVFGKPVRVHLSQKYKRIKKPEGKPDQKFDQ KQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEMETREDAMAMVDHCLKKALWFQ GRCVKVDLSEKYKKLVLRIPNRGIDLLKKDKSRKRSYSPDGKESPSDKKSKTDGSQKTESSTEGKEQEEK SGEDGEKDTKDDQTEQEPNMLLESEDELLVDEEEAAALLESGSSVGDETDLANLGDVASDGKKEPSDKAV KKDGSASAAAKKKLKKVDKIEELDQENEAALENGIKNEENTEPGAESSENADDPNKDTSENADGQSDENK DDYTIPDEYRIGPYQPNVPVGIDYVIPKTGFYCKLCSLFYTNEEVAKNTHCSSLPHYQKLKKFLNKLAEE RRQKKET myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 94.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061322 |
Locus ID | 9782 |
UniProt ID | P43243 |
Refseq Size | 3921 |
Cytogenetics | 5q31.2 |
Refseq ORF | 2541 |
Synonyms | ALS21; MPD2; VCPDM |
Summary | This gene encodes a nuclear matrix protein, which is proposed to stabilize certain messenger RNA species. Mutations of this gene are associated with distal myopathy 2, which often includes vocal cord and pharyngeal weakness. Alternatively spliced transcript variants, including read-through transcripts composed of the upstream small nucleolar RNA host gene 4 (non-protein coding) and matrin 3 gene sequence, have been identified. Pseudogenes of this gene are located on chromosomes 1 and X. [provided by RefSeq, Aug 2013] |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
RNP-MaP: In-cell analysis of protein interaction networks defines functional hubs in RNA
,Weidmann, CA;Mustoe, AM;Jariwala, PB;Calabrese, JM;,
bioRxiv
[MATR3]
|
Mutations in the Matrin 3 gene cause familial amyotrophic lateral sclerosis
,Johnson, JO;Pioro, EP;Boehringer, A;Chia, R;Feit, H;Renton, AE;Pliner, HA;Abramzon, Y;Marangi, G;Winborn, BJ;Gibbs, JR;Nalls, MA;Morgan, S;Shoai, M;Hardy, J;Pittman, A;Orrell, RW;Malaspina, A;Sidle, KC;Fratta, P;Harms, MB;Baloh, RH;Pestronk, A;Weihl, CC;Rogaeva, E;Zinman, L;Drory, VE;Borghero, G;Mora, G;Calvo, A;Rothstein, JD;ITALSGEN, ;Drepper, C;Sendtner, M;Singleton, AB;Taylor, JP;Cookson, MR;Restagno, G;Sabatelli, M;Bowser, R;Chiò, A;Traynor, BJ;,
Nat. Neurosci. 664-6 17 5. May 2014
,PubMed ID 24686783
[MATR3]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404685 | MATR3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412874 | MATR3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434310 | MATR3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404685 | Transient overexpression lysate of matrin 3 (MATR3), transcript variant 1 |
CNY 3080.00 |
|
LY412874 | Transient overexpression lysate of matrin 3 (MATR3), transcript variant 2 |
CNY 3080.00 |
|
LY434310 | Transient overexpression lysate of matrin 3 (MATR3), transcript variant 5 |
CNY 3080.00 |
|
PH323258 | MATR3 MS Standard C13 and N15-labeled recombinant protein (NP_061322) |
CNY 19520.00 |
其它Matrin 3产品