STARD4 (NM_139164) Human Recombinant Protein
CAT#: TP323123
Recombinant protein of human StAR-related lipid transfer (START) domain containing 4 (STARD4), 20 µg
View other "STARD4" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223123 representing NM_139164
Red=Cloning site Green=Tags(s) MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHI RPGPCRLDWDSLMTSLDILENFEENCCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDE KRPEFVRGYNHPCGWFCVPLKDNPNQSLLTGYIQTDLRGMIPQSAVDTAMASTLTNFYGDLRKAL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_631903 |
| Locus ID | 134429 |
| UniProt ID | Q96DR4 |
| Refseq Size | 2264 |
| Cytogenetics | 5q22.1 |
| Refseq ORF | 615 |
| Summary | Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD4 (Soccio et al., 2002 [PubMed 12011452]).[supplied by OMIM, Mar 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408367 | STARD4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408367 | Transient overexpression lysate of StAR-related lipid transfer (START) domain containing 4 (STARD4) |
CNY 3080.00 |
|
| PH323123 | STARD4 MS Standard C13 and N15-labeled recombinant protein (NP_631903) |
CNY 19520.00 |
|
| TP760684 | Purified recombinant protein of Human StAR-related lipid transfer (START) domain containing 4 (STARD4), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
