Pirin (PIR) (NM_003662) Human Recombinant Protein
CAT#: TP323111
Recombinant protein of human pirin (iron-binding nuclear protein) (PIR), transcript variant 1, 20 µg
View other "Pirin" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223111 representing NM_003662
Red=Cloning site Green=Tags(s) MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEG GSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIP KPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQ KIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFER AKTWKSKIGN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003653 |
| Locus ID | 8544 |
| UniProt ID | O00625 |
| Refseq Size | 1316 |
| Cytogenetics | Xp22.2 |
| Refseq ORF | 870 |
| Summary | This gene encodes a member of the cupin superfamily. The encoded protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the encoded protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401212 | PIR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422656 | PIR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401212 | Transient overexpression lysate of pirin (iron-binding nuclear protein) (PIR), transcript variant 1 |
CNY 3080.00 |
|
| LY422656 | Transient overexpression lysate of pirin (iron-binding nuclear protein) (PIR), transcript variant 2 |
CNY 3080.00 |
|
| PH300626 | PIR MS Standard C13 and N15-labeled recombinant protein (NP_001018119) |
CNY 19520.00 |
|
| PH323111 | PIR MS Standard C13 and N15-labeled recombinant protein (NP_003653) |
CNY 19520.00 |
|
| TP300626 | Recombinant protein of human pirin (iron-binding nuclear protein) (PIR), transcript variant 2, 20 µg |
CNY 2900.00 |
